ACBD3 Fragment MS Protein Standard

Golgi resident protein GCP60

ACBD3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ACBD3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ACBD3

Acyl-CoA-binding domain-containing protein 3, Golgi complex-associated protein 1, Golgi phosphoprotein 1, PBR- and PKA-associated protein 7, Peripheral benzodiazepine receptor-associated protein PAP7

Q9H3P7

QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMW