ADCY10 Fragment MS Protein Standard

Adenylate cyclase type 10

ADCY10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ADCY10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ADCY10

AH-related protein, Adenylate cyclase homolog, Germ cell soluble adenylyl cyclase, Testicular soluble adenylyl cyclase

Q96PN6

RNTTYIVIGAVQPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEK