AKAP4 Fragment MS Protein Standard

A-kinase anchor protein 4

AKAP4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AKAP4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AKAP4

A-kinase anchor protein 82 kDa, Major sperm fibrous sheath protein, Protein kinase A-anchoring protein 4

Q5JQC9

SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ