AP1S3 Fragment MS Protein Standard

AP-1 complex subunit sigma-3

AP1S3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AP1S3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AP1S3

Adaptor protein complex AP-1 subunit sigma-1C, Adaptor-related protein complex 1 subunit sigma-1C, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1

Q96PC3

ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY