APBB1IP Fragment MS Protein Standard

Amyloid beta A4 precursor protein-binding family B member 1-interacting protein

APBB1IP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human APBB1IP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

APBB1IP

APBB1-interacting protein 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Retinoic acid-responsive proline-rich protein 1

Q7Z5R6

MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP