ARNTL Fragment MS Protein Standard

Aryl hydrocarbon receptor nuclear translocator-like protein 1

ARNTL Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARNTL protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARNTL

Basic-helix-loop-helix-PAS protein MOP3, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, PAS domain-containing protein 3, bHLH-PAS protein JAP3

O00327

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI