ATF6B Fragment MS Protein Standard

Cyclic AMP-dependent transcription factor ATF-6 beta

ATF6B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATF6B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATF6B

Activating transcription factor 6 beta, Protein G13, cAMP response element-binding protein-related protein, cAMP-responsive element-binding protein-like 1

Q99941

KPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQR