B4GALNT2 Fragment MS Protein Standard

Beta-1,4 N-acetylgalactosaminyltransferase 2

B4GALNT2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human B4GALNT2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

B4GALNT2

Sd(a) beta-1,4-GalNAc transferase, UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase

Q8NHY0

LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA