BAZ1A Fragment MS Protein Standard

Bromodomain adjacent to zinc finger domain protein 1A

BAZ1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BAZ1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BAZ1A

ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, CHRAC subunit ACF1, Williams syndrome transcription factor-related chromatin-remodeling factor 180, hWALp1

Q9NRL2

RGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLRDFLLDIEDRIYQGTLGAIKVTDRHIWR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!