BAZ1B Fragment MS Protein Standard

Product Information
Protein Name
Tyrosine-protein kinase BAZ1B
Description
BAZ1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BAZ1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
BAZ1B
Synonyms
Bromodomain adjacent to zinc finger domain protein 1B, Williams syndrome transcription factor, Williams-Beuren syndrome chromosomal region 10 protein, Williams-Beuren syndrome chromosomal region 9 protein, hWALp2
Uniprot ID
Q9UIG0
Product Sequence
RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket