BPIFA1 Fragment MS Protein Standard

Product Information
Protein Name
BPI fold-containing family A member 1
Description
BPIFA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BPIFA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
BPIFA1
Synonyms
Lung-specific protein X, Nasopharyngeal carcinoma-related protein, Palate lung and nasal epithelium clone protein, Secretory protein in upper respiratory tracts, Short PLUNC1, Tracheal epithelium-enriched protein, Von Ebner protein Hl
Uniprot ID
Q9NP55
Product Sequence
GGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQV

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket