BRIP1 Fragment MS Protein Standard

Fanconi anemia group J protein

BRIP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BRIP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BRIP1

ATP-dependent RNA helicase BRIP1, BRCA1-associated C-terminal helicase 1, BRCA1-interacting protein C-terminal helicase 1

Q9BX63

FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!