CACNA1C Fragment MS Protein Standard

Voltage-dependent L-type calcium channel subunit alpha-1C

CACNA1C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CACNA1C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CACNA1C

Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle, Voltage-gated calcium channel subunit alpha Cav1.2

Q13936

QDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLS