GLCE Fragment MS Protein Standard

D-glucuronyl C5-epimerase

GLCE Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GLCE protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GLCE

Heparan sulfate C5-epimerase, Heparin/heparan sulfate:glucuronic acid C5-epimerase, Heparosan-N-sulfate-glucuronate 5-epimerase

O94923

SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEK