METTL17 Fragment MS Protein Standard

Methyltransferase-like protein 17, mitochondrial

METTL17 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human METTL17 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

METTL17

False p73 target gene protein, Methyltransferase 11 domain-containing protein 1, Protein RSM22 homolog, mitochondrial

Q9H7H0

MENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLENPDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRAR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!