NFKBIZ Fragment MS Protein Standard

NF-kappa-B inhibitor zeta

NFKBIZ Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NFKBIZ protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NFKBIZ

I-kappa-B-zeta, IL-1 inducible nuclear ankyrin-repeat protein, Molecule possessing ankyrin repeats induced by lipopolysaccharide

Q9BYH8

SDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSVKELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!