NSD1 Fragment MS Protein Standard

Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific

NSD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NSD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NSD1

Androgen receptor coactivator 267 kDa protein, Androgen receptor-associated protein of 267 kDa, H3-K36-HMTase, H4-K20-HMTase, Lysine N-methyltransferase 3B, Nuclear receptor-binding SET domain-containing protein 1

Q96L73

ASGRASAGAEQTPGPLSQSPGLVKQAKQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIVAGQTLAQSCWSAGSTQTLAQTCWSLGR