ST6GALNAC6 Fragment MS Protein Standard

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6

ST6GALNAC6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ST6GALNAC6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ST6GALNAC6

GalNAc alpha-2,6-sialyltransferase VI, ST6GalNAc VI, Sialyltransferase 7F

Q969X2

SRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQR