STAB2 Fragment MS Protein Standard

Stabilin-2

STAB2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human STAB2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

STAB2

FAS1 EGF-like and X-link domain-containing adhesion molecule 2, Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 2, Hyaluronan receptor for endocytosis

Q8WWQ8

VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRR