USP32 Fragment MS Protein Standard

Ubiquitin carboxyl-terminal hydrolase 32

USP32 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human USP32 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

USP32

Deubiquitinating enzyme 32, Renal carcinoma antigen NY-REN-60, Ubiquitin thioesterase 32, Ubiquitin-specific-processing protease 32

Q8NFA0

WRALYHWYGANLALPRPVIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDED