ZNF350 Fragment MS Protein Standard

Zinc finger protein 350

ZNF350 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZNF350 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZNF350

KRAB zinc finger protein ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein ZBRK1

Q9GZX5

FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!