AASS Fragment MS Protein Standard

Alpha-aminoadipic semialdehyde synthase, mitochondrial

AASS Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AASS protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AASS

LKR/SDH

Q9UDR5

AEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!