ABCB5 Fragment MS Protein Standard

ATP-binding cassette sub-family B member 5

ABCB5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ABCB5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ABCB5

ABCB5 P-gp, P-glycoprotein ABCB5

Q2M3G0

DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL