ABCF2 Fragment MS Protein Standard

ATP-binding cassette sub-family F member 2

ABCF2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ABCF2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ABCF2

Iron-inhibited ABC transporter 2

Q9UG63

CVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQD