ABHD10 Fragment MS Protein Standard

Mycophenolic acid acyl-glucuronide esterase, mitochondrial

ABHD10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ABHD10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ABHD10

Alpha/beta hydrolase domain-containing protein 10

Q9NUJ1

STLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSM