ABRA Fragment MS Protein Standard

Actin-binding Rho-activating protein

ABRA Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ABRA protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ABRA

Striated muscle activator of Rho-dependent signaling

Q8N0Z2

AKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQAPKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYERGGDVSHLSHR