ACAD8 Fragment MS Protein Standard

Isobutyryl-CoA dehydrogenase, mitochondrial

ACAD8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ACAD8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ACAD8

Activator-recruited cofactor 42 kDa component, Acyl-CoA dehydrogenase family member 8

Q9UKU7

LSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMA