ADAM17 Fragment MS Protein Standard

Disintegrin and metalloproteinase domain-containing protein 17

ADAM17 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ADAM17 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ADAM17

Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme

P78536

SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR