ADAM23 Fragment MS Protein Standard

Disintegrin and metalloproteinase domain-containing protein 23

ADAM23 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ADAM23 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ADAM23

Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3

O75077

LLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILD