ADAR Fragment MS Protein Standard

Double-stranded RNA-specific adenosine deaminase

ADAR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ADAR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ADAR

136 kDa double-stranded RNA-binding protein, Interferon-inducible protein 4, K88DSRBP

P55265

ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDY