AGFG2 Fragment MS Protein Standard

Arf-GAP domain and FG repeat-containing protein 2

AGFG2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AGFG2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AGFG2

HIV-1 Rev-binding protein-like protein, Rev/Rex activation domain-binding protein related

O95081

KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF