AGGF1 Fragment MS Protein Standard

Angiogenic factor with G patch and FHA domains 1

AGGF1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AGGF1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AGGF1

Angiogenic factor VG5Q, G patch domain-containing protein 7, Vasculogenesis gene on 5q protein

Q8N302

TAVNPATIGREKDMEHTLRIPEVGVSKFHAEIYFDHDLQSYVLVDQGSQNGTIVNGKQILQPKTKCDPYVLEHGDEVKIGETVL