AGPAT5 Fragment MS Protein Standard

1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon

AGPAT5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AGPAT5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AGPAT5

1-acylglycerol-3-phosphate O-acyltransferase 5, Lysophosphatidic acid acyltransferase epsilon

Q9NUQ2

ANHQSTVDWIVADILAIRQNALGHVRYVLKEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLK