AHCYL2 Fragment MS Protein Standard

Putative adenosylhomocysteinase 3

AHCYL2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AHCYL2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AHCYL2

S-adenosyl-L-homocysteine hydrolase 3, S-adenosylhomocysteine hydrolase-like protein 2

Q96HN2

GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI