AKAP9 Fragment MS Protein Standard

A-kinase anchor protein 9

AKAP9 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AKAP9 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AKAP9

A-kinase anchor protein 350 kDa, A-kinase anchor protein 450 kDa, AKAP 120-like protein, Centrosome- and Golgi-localized PKN-associated protein, Protein hyperion, Protein kinase A-anchoring protein 9, Protein yotiao

Q99996

EKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!