AKIP1 Fragment MS Protein Standard

A-kinase-interacting protein 1

AKIP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AKIP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AKIP1

Breast cancer-associated gene 3 protein, PKA-interacting protein, Proline-rich protein BCA3

Q9NQ31

VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE