ALDH4A1 Fragment MS Protein Standard

Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

ALDH4A1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ALDH4A1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ALDH4A1

Aldehyde dehydrogenase family 4 member A1, L-glutamate gamma-semialdehyde dehydrogenase

P30038

KSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLE