ALKBH2 Fragment MS Protein Standard

Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2

ALKBH2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ALKBH2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ALKBH2

Alkylated DNA repair protein alkB homolog 2, DNA oxidative demethylase ALKBH2, Oxy DC1

Q6NS38

DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK