ALKBH8 Fragment MS Protein Standard

Product Information
Protein Name
Alkylated DNA repair protein alkB homolog 8
Description
ALKBH8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ALKBH8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
ALKBH8
Synonyms
Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8, tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8
Uniprot ID
Q96BT7
Product Sequence
LPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket