ANAPC1 Fragment MS Protein Standard

Anaphase-promoting complex subunit 1

ANAPC1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ANAPC1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ANAPC1

Cyclosome subunit 1, Mitotic checkpoint regulator, Testis-specific gene 24 protein

Q9H1A4

PPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH