APBB1IP Fragment MS Protein Standard

Product Information
Protein Name
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
Description
APBB1IP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human APBB1IP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
APBB1IP
Synonyms
APBB1-interacting protein 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Retinoic acid-responsive proline-rich protein 1
Uniprot ID
Q7Z5R6
Product Sequence
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket