APOA1BP Fragment MS Protein Standard

NAD(P)H-hydrate epimerase

APOA1BP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human APOA1BP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

APOA1BP

Apolipoprotein A-I-binding protein, NAD(P)HX epimerase, YjeF N-terminal domain-containing protein 1

Q8NCW5

DIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL