APPL1 Fragment MS Protein Standard

DCC-interacting protein 13-alpha

APPL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human APPL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

APPL1

Adapter protein containing PH domain, PTB domain and leucine zipper motif 1

Q9UKG1

VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ