APPL2 Fragment MS Protein Standard

DCC-interacting protein 13-beta

APPL2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human APPL2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

APPL2

Adapter protein containing PH domain, PTB domain and leucine zipper motif 2

Q8NEU8

KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA