ARHGAP33 Fragment MS Protein Standard

Rho GTPase-activating protein 33

ARHGAP33 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARHGAP33 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARHGAP33

Rho-type GTPase-activating protein 33, Sorting nexin-26, Tc10/CDC42 GTPase-activating protein

O14559

PPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKP