ARHGAP4 Fragment MS Protein Standard

Rho GTPase-activating protein 4

ARHGAP4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARHGAP4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARHGAP4

Rho-GAP hematopoietic protein C1, Rho-type GTPase-activating protein 4, p115

P98171

DRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYT