ARHGEF3 Fragment MS Protein Standard

Rho guanine nucleotide exchange factor 3

ARHGEF3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARHGEF3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARHGEF3

Exchange factor found in platelets and leukemic and neuronal tissues

Q9NR81

HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSM