ARID5A Fragment MS Protein Standard

AT-rich interactive domain-containing protein 5A

ARID5A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARID5A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARID5A

Modulator recognition factor 1

Q03989

LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH