ASH1L Fragment MS Protein Standard

Histone-lysine N-methyltransferase ASH1L

ASH1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ASH1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ASH1L

ASH1-like protein, Absent small and homeotic disks protein 1 homolog, Lysine N-methyltransferase 2H

Q9NR48

PPSPSFTTPLPPPSYMHAGHLLLNPAKYHKKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQVSMDTGSSRSVLESLKRYRFGKDAVGERYKHKEKHR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!