ASZ1 Fragment MS Protein Standard

Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1

ASZ1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ASZ1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ASZ1

Ankyrin-like protein 1, Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein

Q8WWH4

DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED